PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05001.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 340aa    MW: 38020.3 Da    PI: 7.0773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05001.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.6e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l+ +++++G g+W+++++  g+ R++k+c++rw +yl
  Rsa1.0_05001.1_g00001.1 14 KGLWSPEEDEKLLMYITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                             678*******************************************97 PP

2Myb_DNA-binding45.12.3e-1467110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Rsa1.0_05001.1_g00001.1  67 RGAFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                              89********************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.44961IPR017930Myb domain
SuperFamilySSF466891.28E-2912108IPR009057Homeodomain-like
SMARTSM007174.9E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
CDDcd001671.42E-111761No hitNo description
PROSITE profilePS5129424.90862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2565116IPR009057Homeodomain-like
SMARTSM007176.0E-1366114IPR001005SANT/Myb domain
PfamPF002493.0E-1367110IPR001005SANT/Myb domain
CDDcd001672.28E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLMYIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS SLKKKLRLRG  120
IDPVTHKILT EIETGTDDNT TPVEKCQTTC LVETEGSSST TTGSTNHNNS NTDHLYTGNF  180
GFQRLTLETG SRIQTGSNLG IWISQTGRNH HVDTVPSAVV LPGSMFSSGL TDSTTGYRSS  240
NLGLIELDNS FSTGPMITEQ QPQESNYNNS TFFGTGNLNW GLTMEENQFT VSNNSLQNHS  300
NSSLYSEIKS ENIFFGTEAT NVGMWPCNQL QPQQHAYGHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531000.0AK353100.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-20-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013726331.10.0PREDICTED: transcription repressor MYB6-like isoform X1
RefseqXP_009111345.10.0PREDICTED: transcription repressor MYB6 isoform X1
TrEMBLA0A078J5J40.0A0A078J5J4_BRANA; BnaA09g52130D protein
TrEMBLM4F5G10.0M4F5G1_BRARP; Uncharacterized protein
STRINGBra036317.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.10.0myb domain protein 55